Unbl0ck.xyz valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title unbl0ck.xyz
Description N/A
Keywords N/A
Server Information
WebSite unbl0ck favicon www.unbl0ck.xyz
Host IP 76.223.15.82
Location Seattle, Washington, United States
Related Websites
Site Rank
mrunblock.icu #193,983
unbl4you.surf #1,512,601
nocensor.monster #182,264
proxybit.work #289,286
videoproxy.icu #4,574,689
More to Explore
unifiedpath.org
upymes.online
usavisamrvfeepaymentserviceinmexico.wordpress.com
vaguitos-co.myshopify.com
villamaria-caldas.gov.co
visiondelarte.blogspot.com
vite.co.uk
votame.io
vuelaseguro.com
vyphidroasesores.com
unitedlabs.in
urbantoolshed.com
Unbl0ck.xyz Valuation
US$47,164
Last updated: May 6, 2023

Unbl0ck.xyz has global traffic rank of 656,649 and ranks the 54,326th in India. Its global rank has gone up by 188,929 positions since 3 months ago. Unbl0ck.xyz has an estimated worth of US$ 47,164, based on its estimated Ads revenue. Unbl0ck.xyz receives approximately 4,785 unique visitors each day. Its web server is located in Seattle, Washington, United States, with IP address 76.223.15.82. According to SiteAdvisor, unbl0ck.xyz is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$47,164
Daily Ads Revenue US$25
Monthly Ads Revenue US$775
Yearly Ads Revenue US$9,432
Daily Unique Visitors 4,785
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 656,649
Delta (90 Days) ⬆️ 188,929
Most Popular In Country India
Country Rank 54,326
DNS Records
Host Type TTL Data
unbl0ck.xyz A 600 IP: 76.223.15.82
unbl0ck.xyz MX 3600 Priority: 5
Target: mail.h-email.net.
unbl0ck.xyz NS 3600 Target: ns2-expired.sav.com.
unbl0ck.xyz NS 3600 Target: ns1-expired.sav.com.
unbl0ck.xyz TXT 3600 TXT: v=spf1 ip6:fd1b:212c:a5f9::/48 -all
unbl0ck.xyz SOA 10800 MNAME: ns1-expired.sav.com.
RNAME: hostmaster.unbl0ck.xyz.
Serial: 1683341000
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 86400
HTTP Headers
HTTP/1.1 403 Forbidden
Date: Sat, 06 May 2023 02:45:17 GMT
Content-Type: text/html
Content-Length: 146
Connection: keep-alive
Server: nginx
Vary: Accept-Encoding

Unbl0ck.xyz Whois Information
Domain Name: UNBL0CK.XYZ
Registry Domain ID: D284152524-CNIC
Registrar WHOIS Server: whois-service.virtualcloud.co
Registrar URL: https://www.sav.com/
Updated Date: 2022-04-04T15:42:42.0Z
Creation Date: 2022-03-25T03:31:14.0Z
Registry Expiry Date: 2024-03-25T23:59:59.0Z
Registrar: Sav.com, LLC- 4
Registrar IANA ID: 3894
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: autoRenewPeriod https://icann.org/epp#autoRenewPeriod
Registrant Organization: Privacy Protection
Registrant State/Province: IL
Registrant Country: US
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: NS1-EXPIRED.SAV.COM
Name Server: NS2-EXPIRED.SAV.COM
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: abuse-contact@sav.com
Registrar Abuse Contact Phone: +1.8885808790
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

https://www.centralnic.com/support/rdap <<<

The Whois and RDAP services are provided by CentralNic, and contain
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) CentralNic Ltd (https://www.centralnic.com)

Access to the Whois and RDAP services is rate limited. For more
information, visit https://registrar-console.centralnic.com/pub/whois_guidance.